PDB entry 1gng

View 1gng on RCSB PDB site
Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
Class: transferase
Keywords: protein kinase, gsk3/frattide complex, phosphorylated, active
Deposited on 2001-10-04, released 2002-10-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841
      • conflict see remark 9 (334)
    Domains in SCOP 1.73: d1gnga_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841
      • conflict see remark 9 (334)
    Domains in SCOP 1.73: d1gngb_
  • Chain 'X':
    Compound: frattide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: frattide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gngA (A:)
    mhhhhhhhhhhkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gngA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
    iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
    yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
    ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
    ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gngB (B:)
    mhhhhhhhhhhkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gngB (B:)
    vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
    lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
    rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
    vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
    eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
    rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.