PDB entry 1gng

View 1gng on RCSB PDB site
Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
Deposited on 2001-10-04, released 2002-10-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-03, with a file datestamp of 2002-10-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gnga_
  • Chain 'B':
    Domains in SCOP 1.63: d1gngb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gngA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
    iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
    yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
    ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
    ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gngB (B:)
    vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
    lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
    rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
    vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
    eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
    rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari