PDB entry 1gnf

View 1gnf on RCSB PDB site
Description: solution structure of the n-terminal zinc finger of murine gata-1, nmr, 25 structures
Deposited on 1998-10-12, released 1999-06-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1gnf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnf_ (-)
    gsearecvncgatatplwrrdrtghylcnacglyhkmngqnrplir