PDB entry 1gn8

View 1gn8 on RCSB PDB site
Description: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE IN COMPLEX WITH Mn2+ATP FROM ESCHERICHIA COLI
Class: transferase
Keywords: transferase, coenzyme a biosynthesis, nucleotidyltransferase
Deposited on 2001-10-03, released 2002-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gn8a_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gn8b_
  • Heterogens: SO4, ATP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gn8A (A:)
    mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
    hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
    skewsfissslvkevarhqgdvthflpenvhqalmakla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gn8B (B:)
    mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
    hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
    skewsfissslvkevarhqgdvthflpenvhqalmakla