PDB entry 1gmj

View 1gmj on RCSB PDB site
Description: the structure of bovine if1, the regulatory subunit of mitochondrial f-atpase
Deposited on 2001-09-14, released 2002-01-01
The last revision prior to the SCOP 1.67 freeze date was dated 2002-01-01, with a file datestamp of 2002-01-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.258
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1gmja_
  • Chain 'B':
    Domains in SCOP 1.67: d1gmjb_
  • Chain 'C':
    Domains in SCOP 1.67: d1gmjc_
  • Chain 'D':
    Domains in SCOP 1.67: d1gmjd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gmjA (A:)
    gsesgdnvrssagavrdaggafgkreqaeeeryfrarakeqlaalkkhkeneishhakei
    erlqkeierhkqsikklkqseddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmjA (A:)
    ggafgkreqaeeeryfrarakeqlaalkkhkeneishhakeierlqkeierhkqsikklk
    qsedd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gmjB (B:)
    gsesgdnvrssagavrdaggafgkreqaeeeryfrarakeqlaalkkhkeneishhakei
    erlqkeierhkqsikklkqseddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmjB (B:)
    gafgkreqaeeeryfrarakeqlaalkkhkeneishhakeierlqkeierhkqsikklkq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gmjC (C:)
    gsesgdnvrssagavrdaggafgkreqaeeeryfrarakeqlaalkkhkeneishhakei
    erlqkeierhkqsikklkqseddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmjC (C:)
    gafgkreqaeeeryfrarakeqlaalkkhkeneishhakeierlqkeierhkqsikklk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gmjD (D:)
    gsesgdnvrssagavrdaggafgkreqaeeeryfrarakeqlaalkkhkeneishhakei
    erlqkeierhkqsikklkqseddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmjD (D:)
    gkreqaeeeryfrarakeqlaalkkhkeneishhakeierlqkeierhkqsikklk