PDB entry 1gm5

View 1gm5 on RCSB PDB site
Description:
Deposited on 2001-09-11, released 2001-10-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: 0.27535
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gm5A (A:)
    ftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdleeklqaf
    ldyvkeipnlpearkryriqkslemieklrswflidylecsgeevdlstdiqyakgvgpn
    rkkklkklgietlrdlleffprdyedrrkifklndllpgekvttqgkivsvetkkfqnmn
    iltavlsdglvhvplkwfnqdylqtylkqltgkevfvtgtvksnaytgqyeihnaevtpk
    egeyvrrilpiyrltsgisqkqmrkifeenipslccslketlperilekrkllgvkdayy
    gmhfpktfyhlekarerlayeelfvlqlafqkirkerekhggipkkiegklaeefikslp
    fkltnaqkrahqeirndmisekpmnrllqgdvgsgktvvaqlaildnyeagfqtafmvpt
    silaiqhyrrtvesfskfnihvalligattpsekekiksglrngqidvvigthaliqedv
    hfknlglviideqhrfgvkqrealmnkgkmvdtlvmsatpiprsmalafygdldvtvide
    mppgrkevqtmlvpmdrvnevyefvrqevmrggqafivyplieesdklnvksavemyeyl
    skevfpefklglmhgrlsqeekdrvmlefaegrydilvsttvievgidvpranvmvienp
    erfglaqlhqlrgrvgrggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrg
    pgeffgvkqhglsgfkvadlyrdlkllew
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gm5A (A:)
    ftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdleeklqaf
    ldyvkeipnlpearkryriqkslemieklrswflidylecsgeevdlstdiqyakgvgpn
    rkkklkklgietlrdlleffprdyedrrkifklndllpgekvttqgkivsvetkkfqnmn
    iltavlsdglvhvplkwfnqdylqtylkqltgkevfvtgtvksnaytgqyeihnaevtpk
    egeyvrrilpiyrltsgisqkqmrkifeenipslccslketlperilekrkllgvkdayy
    gmhfpktfyhlekarerlayeelfvlqlafqkirkerekhggipkkiegklaeefikslp
    fkltnaqkrahqeirndmisekpmnrllqgdvgsgktvvaqlaildnyeagfqtafmvpt
    silaiqhyrrtvesfskfnihvalligattpsekekiksglrngqidvvigthaliqedv
    hfknlglviideqhrfealmnkgkmvdtlvmsatpiprsmalafygdldvtvidemppgr
    kevqtmlvpmdrvnevyefvrqevmrggqafivypliksavemyeylskevfklglmhgr
    lsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperfglaqlhqlrgrvg
    rggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrgpgekqhglsgfkvadl
    yrdlkllew