PDB entry 1gm0

View 1gm0 on RCSB PDB site
Description: a form of the pheromone-binding protein from bombyx mori
Deposited on 2001-09-05, released 2001-11-30
The last revision prior to the SCOP 1.61 freeze date was dated 2001-11-30, with a file datestamp of 2001-11-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gm0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gm0A (A:)
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev