PDB entry 1glu

View 1glu on RCSB PDB site
Description: crystallographic analysis of the interaction of the glucocorticoid receptor with dna
Deposited on 1992-08-30, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.196
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1glua_
  • Chain 'B':
    Domains in SCOP 1.55: d1glub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gluA (A:)
    mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
    acryrkclqagmnlearktkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gluB (B:)
    mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
    acryrkclqagmnlearktkk