PDB entry 1gli

View 1gli on RCSB PDB site
Description: deoxyhemoglobin t38w (alpha chains), v1g (alpha and beta chains)
Class: oxygen transport
Keywords: mutant, engineered mutant, site directed mutant, oxygen transport
Deposited on 1996-02-22, released 1996-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyhemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (1-140)
      • engineered (37)
    Domains in SCOPe 2.05: d1glia_
  • Chain 'B':
    Compound: deoxyhemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1glib_
  • Chain 'C':
    Compound: deoxyhemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (1-140)
      • engineered (37)
    Domains in SCOPe 2.05: d1glic_
  • Chain 'D':
    Compound: deoxyhemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1glid_
  • Heterogens: PO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gliA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpwtktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gliB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gliC (C:)
    mlspadktnvkaawgkvgahageygaealermflsfpwtktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gliD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh