PDB entry 1gl8

View 1gl8 on RCSB PDB site
Description: solution structure of thioredoxin m from spinach, oxidized form
Deposited on 2001-08-30, released 2001-12-13
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-13, with a file datestamp of 2001-12-13.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1gl8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gl8A (A:)
    vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
    pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl