PDB entry 1gl8

View 1gl8 on RCSB PDB site
Description: solution structure of thioredoxin m from spinach, oxidized form
Class: oxidoreductase
Keywords: oxidoreductase, electron transport, redox-active center
Deposited on 2001-08-30, released 2001-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gl8A (A:)
    vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
    pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl