PDB entry 1gl7

View 1gl7 on RCSB PDB site
Description: plasmid coupling protein trwb in complex with the non-hydrolisable atp-analogue adpnp.
Deposited on 2001-08-28, released 2002-05-16
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-16, with a file datestamp of 2002-05-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gl7a_
  • Chain 'B':
    Domains in SCOP 1.61: d1gl7b_
  • Chain 'D':
    Domains in SCOP 1.61: d1gl7d_
  • Chain 'E':
    Domains in SCOP 1.61: d1gl7e_
  • Chain 'F':
    Domains in SCOP 1.61: d1gl7f_
  • Chain 'G':
    Domains in SCOP 1.61: d1gl7g_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gl7A (A:)
    efggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgks
    vllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndydw
    qryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgf
    legtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfitw
    redmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrka
    glrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehever
    dryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfan
    rqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl7A (A:)
    efggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgks
    vllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndydw
    qryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgf
    legtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfitw
    redmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrka
    glrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehever
    dervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gl7B (B:)
    vgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatg
    tgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirn
    dydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfdd
    lrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnl
    fitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltk
    grkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeh
    everdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleik
    qfanrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl7B (B:)
    vgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatg
    tgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirn
    dydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfdd
    lrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnl
    fitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltk
    grkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeh
    everdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gl7D (D:)
    gqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgt
    gksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirnd
    ydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddl
    rgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlf
    itwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkg
    rkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehe
    verdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikq
    fanrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl7D (D:)
    gqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgt
    gksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirnd
    ydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddl
    rgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlf
    itwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkg
    rkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehe
    verdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gl7E (E:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
    anrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl7E (E:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gl7F (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafvegt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl7F (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafvegt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gl7G (G:)
    efggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgks
    vllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndydw
    qryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgf
    legtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfitw
    redmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrka
    glrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehever
    dryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfan
    rqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl7G (G:)
    efggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgks
    vllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndydw
    qryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgf
    legtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfitw
    redmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrka
    glrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehever
    dervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg