PDB entry 1gl6

View 1gl6 on RCSB PDB site
Description:
Deposited on 2001-08-28, released 2002-05-16
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-16, with a file datestamp of 2002-05-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gl6a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gl6b_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gl6d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gl6e_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gl6f_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gl6g_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gl6A (A:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
    anrqpafvegt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl6A (A:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdalervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafvegt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gl6B (B:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl6B (B:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gl6D (D:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
    anrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl6D (D:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gl6E (E:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
    anrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl6E (E:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gl6F (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl6F (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gl6G (G:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl6G (G:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg