PDB entry 1gki

View 1gki on RCSB PDB site
Description:
Deposited on 2001-08-14, released 2002-05-16
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-16, with a file datestamp of 2002-05-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gkia_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gkib_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gkid_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gkie_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gkif_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gkig_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gkiA (A:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafvegt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkiA (A:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdalervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafvegt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gkiB (B:)
    svgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngat
    gtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneir
    ndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfd
    dlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggn
    lfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladalt
    kgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslge
    heverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvplei
    kqfanrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkiB (B:)
    svgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngat
    gtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneir
    ndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfd
    dlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggn
    lfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladalt
    kgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslge
    heverdrervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gkiD (D:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
    anrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkiD (D:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gkiE (E:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
    anrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkiE (E:)
    qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
    ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
    dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
    gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
    twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
    kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
    erdlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gkiF (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkiF (F:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gkiG (G:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkiG (G:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg