PDB entry 1gk7

View 1gk7 on RCSB PDB site
Description: human vimentin coil 1a fragment (1a)
Deposited on 2001-08-08, released 2002-03-15
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-15, with a file datestamp of 2002-03-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19785
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gk7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk7A (A:)
    gsnekvelqelndrfanyidkvrfleqqnkillaeleql