PDB entry 1gjz

View 1gjz on RCSB PDB site
Description: solution structure of a dimeric n-terminal fragment of human ubiquitin
Deposited on 2001-08-06, released 2001-12-13
The last revision prior to the SCOP 1.71 freeze date was dated 2001-12-13, with a file datestamp of 2001-12-13.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gjza_
  • Chain 'B':
    Domains in SCOP 1.71: d1gjzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gjzA (A:)
gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gjzB (B:)
gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle