PDB entry 1gjr

View 1gjr on RCSB PDB site
Description: ferredoxin-nadp+ reductase complexed with nadp+ by cocrystallization
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, nadp, fad, fnr, nadp reductase
Deposited on 2001-08-01, released 2002-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gjra1, d1gjra2
  • Heterogens: FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gjrA (A:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vety
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gjrA (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety