PDB entry 1gj6

View 1gj6 on RCSB PDB site
Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Deposited on 2001-04-27, released 2002-04-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-27, with a file datestamp of 2002-04-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gj6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gj6A (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn