PDB entry 1git

View 1git on RCSB PDB site
Description: structure of gtp-binding protein
Deposited on 1996-10-16, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1git_ (-)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvgaqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
    vqfvfdavtdviiknnl