PDB entry 1gil

View 1gil on RCSB PDB site
Description: structure of active conformations of gia1 and the mechanism of gtp hydrolysis
Deposited on 1995-01-02, released 1995-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gil_ (-)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsaa
    yylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvgglrserkkwih
    cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
    feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
    fvfdavtdvi