PDB entry 1gia

View 1gia on RCSB PDB site
Description: structure of active conformations of gia1 and the mechanism of gtp hydrolysis
Deposited on 1994-07-20, released 1994-09-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gia_ (-)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsaa
    yylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwih
    cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
    feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
    fvfdavtdvi