PDB entry 1ghu

View 1ghu on RCSB PDB site
Description: nmr solution structure of growth factor receptor-bound protein 2 (grb2) sh2 domain, 24 structures
Deposited on 1996-08-05, released 1997-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ghu__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ghu_ (-)
  gswffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
  yflwvvkfnslnelvdyhrstsvsrnqqiflrdie