PDB entry 1ghl

View 1ghl on RCSB PDB site
Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes
Deposited on 1993-05-04, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ghla_
  • Chain 'B':
    Domains in SCOP 1.71: d1ghlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghlA (A:)
    gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
    srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
    vnvwirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghlB (B:)
    gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
    srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
    vnvwirgcrl