PDB entry 1ggy

View 1ggy on RCSB PDB site
Description: human factor xiii with ytterbium bound in the ion site
Deposited on 1998-07-23, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ggyA (A:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggyA (A:)
    fggrravppnnsnaaeddlptveleflnvtsvhlfkerwdtnkvdhhtdkyennklivrr
    gqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmre
    drsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldne
    kereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikv
    srvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfa
    gvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwnea
    wmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsd
    liyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletal
    mygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpk
    aefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkst
    vltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirp
    nstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ggyB (B:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggyB (B:)
    fggrravppnnsnaaeddlptvelqgqeflnvtsvhlfkerwdtnkvdhhtdkyennkli
    vrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakiv
    mredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyl
    dnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnp
    ikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcw
    vfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcw
    neawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaev
    nsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlale
    talmygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytg
    vpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakq
    kstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfre
    irpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr