PDB entry 1ggu

View 1ggu on RCSB PDB site
Description: human factor xiii with calcium bound in the ion site
Class: transferase
Keywords: transglutaminase, blood coagulation, calcium, transferase
Deposited on 1998-07-22, released 1999-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (coagulation factor xiii)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • conflict (566)
    Domains in SCOPe 2.07: d1ggua1, d1ggua2, d1ggua3, d1ggua4
  • Chain 'B':
    Compound: protein (coagulation factor xiii)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • conflict (566)
    Domains in SCOPe 2.07: d1ggub1, d1ggub2, d1ggub3, d1ggub4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gguA (A:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gguA (A:)
    fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
    qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
    rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnek
    ereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvs
    rvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfag
    vfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneaw
    mtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdl
    iyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpka
    efkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstv
    ltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpn
    stvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gguB (B:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gguB (B:)
    fggrravppnnsnaaeddlptvelqgvvqeflnvtsvhlfkerwdtnkvdhhtdkyennk
    livrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgak
    ivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddav
    yldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrg
    npikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygq
    cwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyh
    cwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfa
    evnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerla
    letalmygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfy
    tgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvla
    kqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmf
    reirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr