PDB entry 1ggt

View 1ggt on RCSB PDB site
Description: three-dimensional structure of a transglutaminase: human blood coagulation factor xiii
Class: blood coagulation
Keywords: blood coagulation
Deposited on 1994-01-25, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ggtA (A:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggtA (A:)
    fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
    qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
    rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnek
    ereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvs
    rvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfag
    vfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneaw
    mtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdl
    iyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ggtB (B:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggtB (B:)
    fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
    qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
    rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnek
    ereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvs
    rvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfag
    vfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneaw
    mtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdl
    iyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr