PDB entry 1ggr

View 1ggr on RCSB PDB site
Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Deposited on 2000-09-18, released 2000-11-15
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-15, with a file datestamp of 2000-11-15.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ggra_
  • Chain 'B':
    Domains in SCOP 1.55: d1ggrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ggrA (A:)
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ggrB (B:)
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele