PDB entry 1ggi

View 1ggi on RCSB PDB site
Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Deposited on 1993-04-02, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggiH (H:)
    qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggiJ (J:)
    qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggiL (L:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggiM (M:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr