PDB entry 1ggb

View 1ggb on RCSB PDB site
Description: major antigen-induced domain rearrangements in an antibody
Deposited on 1993-07-19, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggbH (H:)
    qvqlqesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggbL (L:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr