PDB entry 1gga

View 1gga on RCSB PDB site
Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
Deposited on 1991-10-11, released 1994-01-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.176
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaA (A:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaB (B:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaO (O:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaP (P:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaQ (Q:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaR (R:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl