PDB entry 1gg3

View 1gg3 on RCSB PDB site
Description: crystal structure of the protein 4.1r membrane binding domain
Class: membrane protein
Keywords: BLOOD, 4.1R, MEMBRANE, 30kD, N-terminal domain, calmodulin, MEMBRANE PROTEIN
Deposited on 2000-07-11, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythroid membrane protein 4.1r
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg3a1, d1gg3a2, d1gg3a3
  • Chain 'B':
    Compound: erythroid membrane protein 4.1r
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg3b1, d1gg3b2, d1gg3b3
  • Chain 'C':
    Compound: erythroid membrane protein 4.1r
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg3c1, d1gg3c2, d1gg3c3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gg3A (A:)
    mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
    eikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallg
    sytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflen
    akklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi
    kirpgeqeqyestigfklpsyraakklwkvcvehhtffr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gg3B (B:)
    mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
    eikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallg
    sytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflen
    akklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi
    kirpgeqeqyestigfklpsyraakklwkvcvehhtffr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gg3C (C:)
    mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
    eikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallg
    sytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflen
    akklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi
    kirpgeqeqyestigfklpsyraakklwkvcvehhtffr