PDB entry 1gfy

View 1gfy on RCSB PDB site
Description: residue 259 is a key determinant of substrate specificity of protein-tyrosine phosphatase 1b and alpha
Class: hydrolase
Keywords: hydrolase
Deposited on 2000-06-26, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protein-tyrosine phosphatase 1b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (Start-297)
      • engineered (46-47)
      • conflict (150)
      • conflict (251)
      • engineered (257-258)
    Domains in SCOPe 2.07: d1gfya_
  • Heterogens: COL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gfyA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryvnvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvlldmrkfrcqliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gfyA (A:)
    mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryvnvspfdhsriklhqe
    dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
    qywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpdf
    gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
    svdikkvlldmrkfrcqliqtadqlrfsylaviegakfimgdssvqdqwkelshed