PDB entry 1gfw

View 1gfw on RCSB PDB site
Description: the 2.8 angstrom crystal structure of caspase-3 (apopain or cpp32)in complex with an isatin sulfonamide inhibitor.
Deposited on 2000-06-16, released 2000-06-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1gfw.1
  • Chain 'B':
    Domains in SCOP 1.55: d1gfw.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfwA (A:)
    sgisldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnk
    ndltreeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrc
    rsltgkpklfiiqacrgteldcgie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfwB (B:)
    hkipvdadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvnrkva
    tefesfsfdatfhakkqipcivsmltkelyfyh