PDB entry 1gfk

View 1gfk on RCSB PDB site
Description: crystal structure of mutant human lysozyme substituted at the surface positions
Class: hydrolase
Keywords: surface, hydrophilic, stability
Deposited on 2000-12-04, released 2000-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (73)
    Domains in SCOP 1.73: d1gfka_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfkA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgannachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv