PDB entry 1gfi

View 1gfi on RCSB PDB site
Description: structures of active conformations of gi alpha 1 and the mechanism of gtp hydrolysis
Deposited on 1994-11-11, released 1995-03-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfi_ (-)
    evkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlk
    idfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsa
    ayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwi
    hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
    lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
    qfvfdavtdviik