PDB entry 1gfd

View 1gfd on RCSB PDB site
Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Deposited on 1994-06-13, released 1994-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1gfd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfd_ (-)
    gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr