PDB entry 1geh

View 1geh on RCSB PDB site
Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Class: lyase
Keywords: Pentagonal toroid decamer, RUBISCO, LYASE
Deposited on 2000-11-13, released 2001-12-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1geha1, d1geha2
  • Chain 'B':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gehb1, d1gehb2
  • Chain 'C':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gehc1, d1gehc2
  • Chain 'D':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gehd1, d1gehd2
  • Chain 'E':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gehe1, d1gehe2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gehA (A:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehA (A:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gehB (B:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehB (B:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gehC (C:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehC (C:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gehD (D:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehD (D:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gehE (E:)
    mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
    wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
    lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
    lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
    levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
    laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
    aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
    ldeyakthkelaralekwghvtpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehE (E:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp