PDB entry 1geh

View 1geh on RCSB PDB site
Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Deposited on 2000-11-13, released 2001-12-15
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-15, with a file datestamp of 2001-12-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gehA (A:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglh
    pgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkel
    aralekwghvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehA (A:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gehB (B:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglh
    pgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkel
    aralekwghvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehB (B:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gehC (C:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglh
    pgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkel
    aralekwghvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehC (C:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gehD (D:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglh
    pgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkel
    aralekwghvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehD (D:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gehE (E:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglh
    pgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkel
    aralekwghvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gehE (E:)
    yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
    akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
    lirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkdd
    enltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkh
    amvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligid
    qlhvgtaeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
    pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
    kwghvtp