PDB entry 1ge9

View 1ge9 on RCSB PDB site
Description: solution structure of the ribosome recycling factor
Class: ribosome
Keywords: three-helix bundle, ribosome
Deposited on 2000-10-19, released 2001-05-16
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ge9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ge9A (A:)
mikeledifkeaekdmkkaveyykneiaglrtsrastalveeikveyygskvpikqlgti
svpehnqiviqvwdqnavpaiekaireelnlnptvqgnvirvtlpplteerrrelvrllh
kiteearvrvrnvrreakemieelegisedekkralerlqkltdkyideinklmeakeke
imsv