PDB entry 1ge9

View 1ge9 on RCSB PDB site
Description: solution structure of the ribosome recycling factor
Deposited on 2000-10-19, released 2001-05-16
The last revision prior to the SCOP 1.71 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ge9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ge9A (A:)
    mikeledifkeaekdmkkaveyykneiaglrtsrastalveeikveyygskvpikqlgti
    svpehnqiviqvwdqnavpaiekaireelnlnptvqgnvirvtlpplteerrrelvrllh
    kiteearvrvrnvrreakemieelegisedekkralerlqkltdkyideinklmeakeke
    imsv