PDB entry 1ge7

View 1ge7 on RCSB PDB site
Description: zinc peptidase from grifola frondosa
Class: hydrolase
Keywords: zinc coordinate, METALLOPROTEASE, HYDROLASE
Deposited on 2000-10-11, released 2001-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-lys metalloendopeptidase
    Species: Grifola frondosa [TaxId:5627]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ge7a_
  • Chain 'B':
    Compound: peptidyl-lys metalloendopeptidase
    Species: Grifola frondosa [TaxId:5627]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ge7b_
  • Heterogens: MAN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ge7A (A:)
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ge7B (B:)
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs