PDB entry 1ge4

View 1ge4 on RCSB PDB site
Description: crystal structure of mutant human lysozyme substituted at left-handed helical positions
Class: hydrolase
Keywords: Non-glycine Residues at Left-handed Helical Structure, Stability
Deposited on 2000-10-06, released 2000-11-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (117)
    Domains in SCOP 1.75: d1ge4a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ge4A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqard
    vrqyvqgcgv