PDB entry 1ge0

View 1ge0 on RCSB PDB site
Description: crystal structure of mutant human lysozyme substituted at left-handed helical positions
Class: hydrolase
Keywords: Non-glycine Residues at Left-handed Helical Structure, Stability, HYDROLASE
Deposited on 2000-10-06, released 2000-11-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • engineered (37)
  Domains in SCOPe 2.01: d1ge0a_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ge0A (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesggntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv