PDB entry 1gdx

View 1gdx on RCSB PDB site
Description:
Deposited on 2000-10-06, released 2000-11-08
The last revision prior to the SCOP 1.71 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1gdxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdxA (A:)
    kvfercelartlkrlgmdgyagislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv