PDB entry 1gdv

View 1gdv on RCSB PDB site
Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution
Class: electron transport
Keywords: Cytochrome c6, Crystal Structure, Red Alga, ELECTRON TRANSPORT
Deposited on 2000-10-06, released 2001-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Porphyra yezoensis [TaxId:2788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gdva_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdvA (A:)
    adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
    fggrlvdediedaanyvlsqsekgw