PDB entry 1gdv

View 1gdv on RCSB PDB site
Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution
Class: electron transport
Keywords: Cytochrome c6, Red Alga, ELECTRON TRANSPORT
Deposited on 2000-10-06, released 2001-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c6
  Species: Porphyra yezoensis [TaxId:2788]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WKJ8 (0-84)
  Domains in SCOPe 2.08: d1gdva_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gdvA (A:)
  adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
  fggrlvdediedaanyvlsqsekgw