PDB entry 1gds

View 1gds on RCSB PDB site
Description: hiv-1 capsid protein, amino-terminal core domain residues 1-151, nmr: models 1-17 of a 50 model set
Deposited on 1996-07-03, released 1996-12-30
The last revision prior to the SCOP 1.65 freeze date was dated 1996-12-30, with a file datestamp of 1996-12-30.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1gds__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gds_ (-)
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil