PDB entry 1gdo

View 1gdo on RCSB PDB site
Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate
Deposited on 1996-04-05, released 1996-10-14
The last revision prior to the SCOP 1.67 freeze date was dated 1999-10-04, with a file datestamp of 1999-10-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1gdoa_
  • Chain 'B':
    Domains in SCOP 1.67: d1gdob_
  • Chain 'C':
    Domains in SCOP 1.67: d1gdoc_
  • Chain 'D':
    Domains in SCOP 1.67: d1gdod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gdoA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdoA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gdoB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdoB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gdoC (C:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdoC (C:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gdoD (D:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdoD (D:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq