PDB entry 1gdl

View 1gdl on RCSB PDB site
Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1994-09-14, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: leghemoglobin (nitrogen monoxy)
  Species: Lupinus luteus [TaxId:3873]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02240 (0-152)
    • conflict (78)
    • conflict (149)
  Domains in SCOPe 2.08: d1gdla_
• Heterogens: HEM, NO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gdlA (A:)
  galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
  qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
  vvgakwseelnsawtiaydelaivikkemddaa