PDB entry 1gdk

View 1gdk on RCSB PDB site
Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)
Deposited on 1994-09-14, released 1995-02-27
The last revision prior to the SCOP 1.63 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1gdk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gdk_ (-)
  galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
  qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
  vvgakwseelnsawtiaydelaivikkemddaa